PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00049.1.g03190.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 400aa    MW: 43742.1 Da    PI: 9.6781
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00049.1.g03190.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.61.3e-24175219145
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                   d+epgrCrRtDGKkWRCsr++++++k+CE+H+hrg++rsrk++e+
  Zjn_sc00049.1.g03190.1.am.mk 175 DPEPGRCRRTDGKKWRCSREAYGDSKYCEKHIHRGKNRSRKPVEA 219
                                   79****************************************986 PP

2QLQ58.42.1e-20101135236
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                                    FTa+Q+q+L++Q+l+yKy+a ++PvP++L+++++
  Zjn_sc00049.1.g03190.1.am.mk 101 LFTASQWQELEHQALIYKYMATGAPVPHDLVVPLR 135
                                   5*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.0E-9100136IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.295101136IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.4E-15102134IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.458175219IPR014977WRC domain
PfamPF088795.6E-20176218IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MMTVIQHSAA RRPAALTPAQ TLETRVLNSA FTVTHHLPRL LQSDLASVES SEQLSAPSCP  60
RWVLVLARVE RERERERERV RSMMLSGHTG GAAAGRGGRR LFTASQWQEL EHQALIYKYM  120
ATGAPVPHDL VVPLRLATGV DTVPSLAFPP QPPSLGYWGC YGAAAAQFGR KAAEDPEPGR  180
CRRTDGKKWR CSREAYGDSK YCEKHIHRGK NRSRKPVEAT TSPATTVNNA AAYRPSALSI  240
SPPAPNAPAP PPSYGHVHHY HHPLHHHGSN SASPLQLHLD AAGYQYAHAH TSLFPGGYGG  300
PSARELQEAE LRRQRCLALG ADLSLDKPAA TATEKPLRRF FDEWNGGGDD ATQLSISMPT  360
ASPSASRYHN AAGSARREKH PFSHQLHELD TVSFKFAEAL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17080RERERERERVR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0349191e-123BT034919.1 Zea mays full-length cDNA clone ZM_BFb0028B17 mRNA, complete cds.
GenBankBT0358751e-123BT035875.1 Zea mays full-length cDNA clone ZM_BFb0086L11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964939.11e-112PREDICTED: growth-regulating factor 2-like isoform X2
RefseqXP_004964938.11e-112PREDICTED: growth-regulating factor 2-like isoform X1
SwissprotQ6AWY75e-89GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLK3XYB41e-112K3XYB4_SETIT; Uncharacterized protein
STRINGSi006922m1e-112(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-39growth-regulating factor 5